PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g36660.1.p
Common NameBRADI_3g36660, LOC100829213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 358aa    MW: 38994.8 Da    PI: 6.6433
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g36660.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEde+l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
  Bradi3g36660.1.p 14 KGPWTSEEDEKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding46.77.3e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k+ w+++l
  Bradi3g36660.1.p  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-RRTDNEIKNCWNTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.042961IPR017930Myb domain
SuperFamilySSF466891.28E-2911108IPR009057Homeodomain-like
SMARTSM007177.2E-141363IPR001005SANT/Myb domain
PfamPF002498.4E-161461IPR001005SANT/Myb domain
CDDcd001674.24E-111661No hitNo description
PROSITE profilePS5129424.43862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2565116IPR009057Homeodomain-like
SMARTSM007171.2E-1566114IPR001005SANT/Myb domain
PfamPF002493.5E-1467112IPR001005SANT/Myb domain
CDDcd001671.80E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRSPCCDKI GLKKGPWTSE EDEKLLAYIE EHGHGSWRAL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPRRT DNEIKNCWNT HLKKRLAKMG  120
IDPVTHKATN GALIGTADIK SAKAAASLSH MAQWESARLE AEGRLAQESK MRTSASTQTS  180
LHPQPMNPSA SAASPCLDVL HAWQGAEIDL ESPTSTLTFT GSNSGMLPIQ VTTSLGISKS  240
NSTMWQQTCD ELEGEESEWK FLSKQQLQGL EGKERGEDII GSEQPWFTGM VGVGAGFTDM  300
LLDGSSVHGT SECWGESSNG HAEHSNQVSG DGESKTYWSG ILGMVNSELP SQPPPLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574525.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLI1I7B60.0I1I7B6_BRADI; Uncharacterized protein
STRINGBRADI3G36660.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.11e-107myb domain protein 106